PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000111.1.g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 955aa    MW: 109785 Da    PI: 6.9499
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000111.1.g00008.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR170.92.9e-2254138190
                            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevt 79 
                                     +fYn Y+ke GF +r+s+s  +++ +e +++++ Cs  g++++++ +     ++r+etrtgC a++++k+ ++++w++ 
  FANhyb_rscf00000111.1.g00008.1  54 DFYNLYGKEQGFGIRVSNSWFRSKRKERYRAKLSCSSAGFKKKSDAN-----NPRPETRTGCPAMVVIKLVDSQRWRIV 127
                                     6*********************999******************9988.....9************************** PP

                            FAR1  80 kleleHnHela 90 
                                     + el+HnH+++
  FANhyb_rscf00000111.1.g00008.1 128 ESELQHNHQVS 138
                                     ********987 PP

2FAR137.11.1e-113834264790
                            FAR1  47 ktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                                     k+++++++r+etrtgC a++++k+ ++++w++ + el+HnH+++
  FANhyb_rscf00000111.1.g00008.1 383 KKSDANNPRPETRTGCPAMIVIKLVDSQRWRIVESELQHNHQVS 426
                                     2456789**********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.0E-2054139IPR004330FAR1 DNA binding domain
PfamPF105512.7E-20261338IPR018289MULE transposase domain
PfamPF031011.3E-9382427IPR004330FAR1 DNA binding domain
PfamPF105511.5E-25549641IPR018289MULE transposase domain
PROSITE profilePS509669.396835871IPR007527Zinc finger, SWIM-type
PfamPF044347.3E-4843868IPR007527Zinc finger, SWIM-type
SMARTSM005751.6E-6846873IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 955 aa     Download sequence    Send to blast
MEEVCLNSEP VFDEGDEYDL EGGHDAGNGE TQCKQVSPQP TVGLEFDSFD EAYDFYNLYG  60
KEQGFGIRVS NSWFRSKRKE RYRAKLSCSS AGFKKKSDAN NPRPETRTGC PAMVVIKLVD  120
SQRWRIVESE LQHNHQVSPQ IKRFYKSHKK MIIAAKNAQP QPDPVTEVHT IKLYRTSVMD  180
VGCNGCSTLS ATEGLNPIDH SQHLELREGD AHAVYNYFCR MKLTNPNFYY LMDLDDDGRL  240
RNVFWADARS RAAYGYFCDT VAIDTTCLAN KYELPLISFV GVNHHGQSVL FGCGFLGVES  300
VDCYVWMLRA WLKCMLGRPP QVFITDKCKP LQNAVSEMEE VCLNSEPVFD EGDEYDLEGG  360
HDAGNGETQC KQVSPQPTVG FKKKSDANNP RPETRTGCPA MIVIKLVDSQ RWRIVESELQ  420
HNHQVSPQIK RFYKSHKKMI IAAKNAQPQP DPVTEVHTIK LYRTSVRDVG CNGCSTLSAT  480
EGLNPIDHSQ HLELREGDAH AVYNYFCRMK LTNPNFYYLM DLDDDGRLRN VFWADARSRA  540
AYGYFCDTVA IDTTCLANKY ELPMISFFGV NHHGQSVLFG CGFLGVESVD CYVWMLRAWL  600
KCMLGRPPQV FITDKCKPLQ NAVSEVIPEA RHCCCLSYIT QKVPEKLGGL KGYEAIRRHL  660
HKSIYDSLKI AEFETSWAEM IKRHELGNNK WLQQLYEDRQ NWVPVYLKDT FFAGMIPIRK  720
SESLPAFFDG YVHKHTSFKE FVDKYDLALH RKRMKEVVAD QESRTSSFEL KTRCNFEVQL  780
CKVYTKEIFR RFQLEVEGMY SCFNTRQVNV NGPIITYIVK ERVEVEGNEK EVRCYEVLYE  840
TTQVDIRCIC SLFNYKGYLC RHALNVLNYN GVEVIPSRYI LPRWSKDFKH THLLHQGSSS  900
NDVYDPAYWC DHLYKLALPV AEEGAQSEEH YKTTLQALEK LLNKFHLVED TLNVT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004292980.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6-like
RefseqXP_011459168.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6-like
TrEMBLM5Y3I60.0M5Y3I6_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s27240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52520.10.0FAR1-related sequence 6